Abstract
The transcription factor Elk-1 plays a key role in cell differentiation, proliferation and apoptosis. This role is thought to arise from its phosphorylation by activated extracellular signal-regulated kinases (ERKs), a critical posttranslational event for the transcriptional activity of the ternary complex composed of Elk-1 and a dimer of serum response factor (SRF) at the serum response element (SRE) regulatory site of transcription. In addition to its nuclear localization, Elk-1 is found in the dendrites and soma of neuronal cells and recent evidence implicate a cytoplasmic proapoptotic function of Elk-1, via its association with the mitochondrial permeability transition pore complex. Thus, the nuclear versus cytoplasmic localization of Elk-1 seems to be crucial for its biological function. In this study we show that the excitatory neurotransmitter, glutamate, induces an ERK-dependent Elk-1 activation and nuclear relocalization. We demonstrate that Elk-1 phosphorylation on Ser383/389 has a dual function and triggers both Elk-1 nuclear translocation and SRE-dependent gene expression. Mutating these sites into inactive residues or using a synthetic penetrating peptide (TAT–DEF–Elk-1), which specifically interferes with the DEF docking domain of Elk-1, prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 (mitogen- and stress-activated protein kinase 1), a CREB kinase downstream from ERK- activation. This results in a differential regulation of glutamate-induced IEG regulation when compared with classical inhibitors of the ERK pathway. Using the TAT–DEF–Elk-1 peptide or the dominant-negative version of Elk-1, we show that Elk-1 phosphorylation controls dendritic elongation, SRF and Actin expression levels as well as cytoskeleton dynamics.
- extracellular signal-regulated kinase (ERK)
- Elk-1
- Elk-1 inhibitor
- trafficking
- gene regulations
- neuronal differentiation
- TAT–DEF–Elk-1 peptide
Introduction
The transcription factor Elk-1 represents a major nuclear target of mitogen-activated protein kinases (MAPK). It belongs to the ternary complex factor (TCFs) family of ETS-domain transcription factors, which also includes SAP-1 and NET/ERP/SAP-2/Elk-3 (Buchwalter et al., 2004). TCFs phosphorylation drives the rapid transcription of immediate early genes (IEG) through a ternary complex formed with a dimer of serum response factor (SRF) on the serum response element (SRE) DNA regulatory site. In addition to their N-terminal ETS DNA-binding domain, TCFs contain a “B box” mediating their interaction with SRF, a C-terminal transactivation domain encompassing the residues phosphorylated by MAPK and two docking domains, the D (or DEJL, for docking site for ERK and JNK, LXL) and the FxFP (or DEF for docking site for ERK, FXF) domains and act as docking sites for MAPK that are crucial for the recognition and interaction with activated MAPK (Sharrocks et al., 2000).
In cell lines, Elk-1 has a nuclear expression which relies on a nuclear localization signal (NLS) present within its ETS domain (Janknecht et al., 1994). Once phosphorylated on Ser383/Ser389, Elk-1 undergoes conformational changes leading to increased DNA-binding and transcriptional activity (Yang et al., 1999). In neuronal cells, we reported that Elk-1 was expressed in both nuclear and cytoplasmic compartments (Sgambato et al., 1998a; Vanhoutte et al., 2001). This suggested that Elk-1 may have additional functions outside the nucleus. More recently, it was shown that Elk-1 plays important extranuclear functions, because it can be associated with the mitochondrial permeability transition pore complex (PTP) where it plays a proapoptotic, role (Barrett et al., 2006a). The posttranslational SUMOylation of Elk-1 controls its nucleus-to-cytoplasm shuttling. Mutating the critical residues for Elk-1 SUMOylation resulted in a faster shuttling of Elk-1 to the nucleus, an effect associated with neuronal differentiation in PC12 cells (Salinas et al., 2004). Thus, the cytoplasm-to-nucleus shuttling of Elk-1 seems to be important for deciphering its role in cell survival and/or neuronal differentiation.
During electrical stimulation of the corticostriatal pathway (Sgambato et al., 1998a), glutamate application in striatal slices (Vanhoutte et al., 1999) or cocaine administration (Valjent et al., 2000), Elk-1 becomes phosphorylated by the MAPK/ERK in dendritic, cytoplasmic and nuclear compartments, raising the possibility that Elk-1 activation occurs primarily in dendrites and triggers its translocation to the nucleus in which its controls transcription and long-term neuronal adaptations. Herein, we show that ERK-dependent Elk-1 phosphorylation is necessary and sufficient to drive Elk-1 nuclear translocation and subsequent SRE-driven gene expression. A cell penetrating peptide (TAT–DEF–Elk-1), which mimics the DEF domain of Elk-1, does not interfere with ERK activation but blocks Elk-1 phosphorylation and nuclear translocation as well as SRE-dependent gene regulation. As opposed to classical ERK inhibitors, TAT–DEF–Elk-1 preserves ERK activity toward other substrates. Finally, inhibiting Elk-1 phosphorylation using this inhibitor peptide or overexpression of a nonphosphorylatable version of Elk-1 impairs dendritic elongation in vitro. We conclude that Elk-1 phosphorylation has a dual role in neuronal cells by controlling its nuclear localization and role in transcription. These molecular events are critically involved in neuronal differentiation.
Materials and Methods
Animals and drug administration.
Male C57BL/6J mice (10 weeks old) were purchased from Janvier (Le Genest St. Isle, France). The animals were housed in standard cages with ad libitum access to food and water with a 12/12-h light/dark cycle. All experiments took place during the animal's light cycle. Three days before the experiments, mice were handled for 2–3 min/d. Cocaine (20 mg/kg; Sigma-Aldrich, St. Louis, MO) was injected intraperitoneally and dissolved in 0.9% NaCl. The mitogen activated and extracellular-regulated protein kinase (MEK) inhibitor α-[amino[(4-aminophenyl)thio]methylene]-2(trifluoromethyl)-benzene acetonitrile (SL327) was dissolved in DMSO, diluted twice in sterile water, and injected (50 mg/kg) 1 h before cocaine administration. Animal care was conducted in accordance with the standard ethical guidelines (European Communities Guidelines on the Care and Use of Laboratory Animals: 86/609/EEC).
Neuronal cell cultures.
Striata were dissected out from 14-d-old Swiss mouse embryos (Janvier, France) and prepared as previously described (Brami-Cherrier et al., 2002). Cells were suspended in Neurobasal medium supplemented with B27 (Invitrogen, Cergy Pontoise, France), 500 nm l-glutamine, 60 μg/ml penicillin G and 25 μm β-mercaptoethanol (Sigma, L'Isle d'Abeau, Chasnes, France) and plated into 24-well (1.8 × 105 cells per well) or 6-well (8.6 × 105 cells per well) Nunc (Dutscher, Brumath, France) multiwell plates coated with 50 μg/ml poly-d-lysine (Sigma). After 3 d in vitro (DIV 3), Ara C (cytosine arabinoside, 2.5 μm; Sigma-Aldrich) was added to prevent astrocytes proliferation. The day before the experiment, neurons were put back in Neurobasal medium without Ara C. For all experiments, treatments were performed between DIV 7 and DIV 9, when the majority of cells were of neuronal phenotype with no detectable glial elements. For pharmacological treatments, the various drugs used (see below, Chemical and reagents) were added directly to the medium, and the cells were replaced at 37°C in a humidified atmosphere of 95% air and 5% CO2 for the appropriate time.
cDNA constructs and transfections.
Three different cDNAs were used (Vanhoutte et al., 2001): a dominant-negative Elk-1 (HA–DN–Elk-1, corresponding to Ser383/Ala383 and Ser389/Ala389 mutations), a constitutively active version of Elk-1 (HA–CA–Elk-1, corresponding to Ser383/Asp383 and Ser389/Asp389 mutations) and a wild-type version (HA–Wt–Elk-1). These constructs were cloned in pcDNA3-HA and pAcmCHERRY-N2 expression vectors. Transient transfections of primary striatal cultures with GFP or HA-tagged Elk-1 plasmids were performed using Lipofectamine 2000 (Invitrogen) according to the manufacturer's instructions. Cells (600/mm2) were transfected with 1 μg of DNA for 3.5 h. Neurons were then rinsed with fresh culture medium and put back to 37°C for 24 h before pharmacological treatments. For HA-tagged versions, expression of Elk-1 constructs in transfected neurons was visualized by immunodetection of the HA tag using a monoclonal anti-HA antibody (1:250; Roche Diagnostics, Indianapolis, IN) or a polyclonal anti-HA antibody (1:250; Zymed Laboratories, Invitrogen) and revealed with an anti-mouse FITC-labeled secondary antibody [1:100; Jackson ImmunoResearch, Beckman Coulter (Marseille, France)] or anti-rabbit FITC-conjugated antibody (1:100; Sigma-Aldrich), respectively.
Chemical and reagents.
Primary striatal neurons were incubated with 10 μm U0126 (Calbiochem, San Diego, CA) for 30 min before and during treatment with l-glutamic acid (100 μm; Calbiochem). The unconjugated and FITC-coupled forms of the TAT–DEF–Elk-1 (GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI) as well as the scramble (GRKKRRQRRRPPQSKPSGSQHPIFSLAFVAS) peptides were synthesized by Genosphere Biotechnologies (Paris, France) and applied to striatal neurons during 1 h. To remove the excess of peptide, neurons were washed once with culture media without peptide and put back at 37°C for 30 min before glutamate treatment.
Immunocytochemistry.
After the appropriate time of glutamate treatment, cells were fixed with PBS containing 4% paraformaldehyde (PFA) (added directly to the medium to a final concentration of 2%) for 40 min at room temperature (RT) and then incubated with methanol/acetone solution (50:50) for 10 min at 4°C. After three rinses in PBS, cells were treated with blocking buffer (normal goat serum 10% in PBS) for 2 h at RT (except for P-ERK and P-H3 staining in which the blocking buffer contained 10% fetal calf serum, 1% BSA in PBS). Antibodies raised against c-Fos (1:7000; Santa Cruz Biotechnology, Tebu, Le Perray-en-Yvelines, France), zif 268 (1:2000 in 5% NGS; Santa Cruz Biotechnology), junB (1:500; Santa Cruz Biotechnology), c-jun (1:200; Cell Signaling Technology, Ozyme, Saint Quentin-en-Yvelines, France), MAP-2 (1:1000; Sigma-Aldrich), Elk-1 (1:500; Santa Cruz Biotechnology), phospho-Ser 383 Elk-1 (1:250; Santa Cruz Biotechnology), phospho-Thr 581MSK-1 (mitogen- and stress-activated protein kinase 1; 1:750; Cell Signaling Technology), phospho-Ser133 CREB (1:2000; Upstate Biotechnology) were incubated overnight (O.N) at 4°C diluted in PBS or in PBS containing 1% BSA, 0.05% Tween 20 for P-ERK (dually phosphorylated ERK (Thr202-Tyr204 p44/42 MAPK; 1:500; Cell Signaling Technology) and P-H3 (anti-phospho-Ser10-H3; 1:1000; Upstate Biotechnology) immunocytochemistry. Neurons were then incubated with secondary Cy3-conjugated anti-rabbit (1:2000; GE Healthcare, Little Chalfont, UK) or anti-mouse antibodies (1:2000; Jackson ImmunoResearch). For some experiments, a FITC-coupled anti-rabbit antibody (1:100; Jackson ImmunoResearch) was used for 2 h at RT. After rinses, cells were counterstained with Hoechst (Invitrogen) and mounted under coverslips using Vectashield (Vector Laboratories, Abcys, Paris France). For double labeling experiments and confocal analysis, anti-mouse Alexa Fluor 488 (1:400), anti-mouse Alexa Fluor 546 (1:400), and anti-rabbit Alexa Fluor 568 (1:200; Invitrogen) were used.
Western blots.
After pharmacological treatments for the appropriate time, the culture medium was quickly removed and ice-cold lysis buffer containing a mix of protease and phosphatase inhibitors was added to striatal cells (10 mm Tris-HCl, 30 mm sodium pyrophosphate, 50 mm NaCl, 1% Triton X-100, 50 mm NaF, 5 μm ZnCl2, 100 μm Na3VO4, 1 mm DTT, 100 nm okadaic acid, 2.5 μg/ml aprotinin, 2.5 μg/ml pepstatin, 0.5 mm PMSF, 0.5 mm benzamidine, 2.5 μg/ml leupeptin). Dishes were rapidly placed on dry ice, scraped, lysed for 10 min on ice and vortexed for 1 min. Insoluble material was removed by centrifugation (13,000 × g; 20 min; 4°C). Thirty micrograms of proteins were analyzed by SDS-PAGE on 10% gels as described by Vanhoutte et al. (1999). After blocking of nonspecific sites with 5% nonfat dry milk, blots were incubated O.N at 4°C with primary antibodies diluted in blocking solution with 0.1% Tween 20 [(1:1000, phospho-CREB; Upstate Biotechnology) (1:250, phospho-Elk-1; Santa Cruz Biotechnology) (1:2500, phosphorylated ERK Thr202-Tyr204 p44/42 MAPK; Cell Signaling Technology) (1:500, phospho-MSK-1; Cell Signaling Technology) (1:200, SRF; Santa Cruz Biotechnology) (1:10,000, actin; Sigma-Aldrich) (1:5000, β-tubulin; Sigma-Aldrich)]. Blots were then washed and incubated for 1 h at RT with anti-rabbit (1:5000; GE Healthcare) or anti-mouse horseradish peroxidase (HRP)-conjugated antibodies diluted (1:5000; GE Healthcare) in the blocking solution with 0.1% Tween 20. Proteins were detected by chemiluminescence using the ECL kit (GE Healthcare).
Subcellular fractionation.
Neurons were placed on ice and scraped gently in an ice-cold hypotonic lysis buffer [(HEPES 5 mm, pH 7.9, MgCl2 1.5 mm, KCl 10 mm, Triton X-100 0.125% and a mix of protease and phosphatase inhibitors (see above, Western blots)]. Lysates were incubated on ice during 10 min and centrifuged at 4000 × g for 10 min at 4°C. The soluble fraction, corresponding to the cytoplasm, was collected and kept on ice. The pellet, corresponding to the nuclear fraction, was washed twice with the hypotonic buffer and incubated for 30 min at 4°C in a hypertonic buffer (HEPES 20 mm, glycerol 25%, NaCl 0.5 mm, MgCl2 0.5 mm, EDTA 0.5 mm, Triton X-100 0.25%) and a mix of protease and phosphatase inhibitors. The resulting cytoplasmic and nuclear fractions were then sonicated and subjected to SDS-PAGE electrophoresis.
Neuronal differentiation.
When indicated, primary striatal neurons were incubated with 10 μm U0126, 10 μm DMSO (Calbiochem), or 5 μm TAT–DEF–Elk-1 (D enantiomer form) at DIV 3 and left in the medium containing the various drugs until DIV 7. At DIV 6, striatal neurons were transfected with a cDNA encoding for GFP to visualize the whole neuronal morphology. At DIV7, neurons were fixed with paraformaldehyde, and a Map-2 staining was performed to visualize dendrites. Constructs encoding mCherry–DN–Elk-1 or -CA–Elk-1 were cotransfected with GFP at DIV 1. Randomly selected photographs were taken (magnification, 20×) with a minimum of 20 pictures per condition. For each transfected neuron, both axonal and dendritic length was determined on the basis of GFP staining using a computer-assisted image analyzer (UTHSCSA Image Tool 3.0). Dendrites were determined based on MAP2 staining and axons as the longest neuritic extension. The mean dendritic length was measured after calculation of the number of processes (magnification, 40×). A minimum of 20 fields (∼50–60 transfected neurons) was analyzed for each experimental condition. The actin cytoskeleton was visualized by a one-step fixation/permeabilization and staining process consisting of the addition of 4% formaldehyde with TRITC-labeled phalloidin (Invitrogen) for 20 min followed by a classical β-tubulin (1:500; Sigma-Aldrich) immunofluorescent staining (FITC).
Quantifications and statistical analysis.
Pictures of immunostaining were taken with a Leica DM LB (Rueil-Malmaison, France) fluorescence microscope coupled to a CCD. Images from immunofluorescence were taken (magnification, 20×) in parallel with Hoechst staining, from 20 independent fields for each experiment (n = 3 independent experiment for each treatment). The number of immunopositive cells was determined using Image Pro Plus 4.5.0.19 software (Media Cybernetics, Wokingham, Berkshire, UK) after setting an intensity threshold applied automatically to all the pictures taken within an experiment. The percentage of immunopositive cells was defined as the number of immunoreactive cells over the number of Hoechst-stained neurons.
For Western blot experiments, films were scanned and analyzed using Scion Image software. Relative kinase and transcription factor expression level or activation was measured by normalization of the density obtained from the protein of interest with a protein used as loading control (β-tubulin) or GAPDH.
Data were expressed as mean ± SEM, and significance was determined by unpaired Student's t test. In all cases, significance was set at p < 0.05.
Results
ERK activation drives nuclear translocation of Elk-1 in striatal neurons in vivo and in vitro
We first wished to analyze whether Elk-1 might translocate to the nucleus after activation. To address this, we used a well established model system of Elk-1 phosphorylation in vivo. During cocaine administration, we have shown a rapid activation of ERK along with Elk-1 within the striatum (Valjent et al., 2000) (Fig. 1A). In this model, we analyzed the subcellular localization of Elk-1 by immunohistochemistry and found it was enriched in the cytoplasm, including neurites, in saline-treated striatal neurons (Fig. 1B). However, during cocaine stimulation, Elk-1 showed a strictly nuclear expression pattern (Fig. 1B). The nuclear expression of Elk-1 was abolished in mice treated with SL327, a selective MEK inhibitor that crosses the blood–brain barrier (Atkins et al., 1998), administered before cocaine. Colabeling of phosphorylated Elk-1 and Elk-1 in cocaine-treated striata, clearly showed an enrichment of nuclear Elk-1 in neurons in which Elk-1 was activated (Fig. 1C). Thus, altogether these data strongly support that Elk-1 translocates from the cytoplasm to the nucleus during phosphorylation by activated ERKs.
To determine the molecular mechanisms responsible for Elk-1 nuclear translocation, and analyze the role of its phosphorylation in this translocation, we set up an in vitro model whereby glutamate activates ERK along with Elk-1 in striatal neurons in culture (Fig. 2A,B). This model system also leads to the activation of the transcription factor CREB (Fig. 2C), as previously described during glutamate stimulation of striatal slices (Vanhoutte et al., 1999). Glutamate-induced Elk-1 and CREB phosphorylation were totally dependent on ERK activation, as shown in experiments in which the selective MEK inhibitor U0126 was applied before glutamate (Fig. 2A–C).
On this in vitro model system, we then analyzed cytoplasmic versus nuclear expression patterns of ERKs and Elk-1. This was performed by confocal analyses of total ERKs and Elk-1 expression (Fig. 2D), and Western blot detection of these proteins after nuclear/cytoplasmic fractionation (Fig. 2E). During glutamate treatment, we found an enrichment of total ERK proteins in the nuclear compartment, with also a preferential nuclear localization of total Elk-1 proteins. In contrast, CREB and GAD proteins, which were used as nuclear and cytoplasmic markers, respectively, did not show any shuttling between the cytoplasm and the nucleus, whatever the treatment (Fig. 2D, bottom, E). Pretreatment of striatal neurons with the MEK inhibitor, U0126, before glutamate, prevented nuclear translocation of ERK and Elk-1 induced by glutamate (Fig. 2D,E).
Phosphorylation of Ser383/Ser389 residues plays a critical role in the cytoplasm to nucleus shuttling of Elk-1
Two critical residues, the Ser383 and Ser389, are phosphorylated in the C-terminal region of Elk-1 (Gille et al., 1995; Zinck et al., 1995) by activated ERKs. Although this posttranslational event is critically involved in SRE-driven gene expression, no study yet addressed its possible role in the cytoplasm to nucleus shuttling of Elk-1 in neurons. To address this, we used transfection assays with cDNA constructs encoding for HA-tagged Elk-1 either in its wild-type (Wt–Elk-1) or mutated (DN–Elk-1 and CA–Elk-1) versions. Thus, Ser383 and Ser389 were mutated into inactive (Ala383/389: dominant-negative Elk-1/DN–Elk-1) or constitutively active (Asp383/389: constitutively active Elk-1/CA–Elk-1) residues for phosphorylation (Vanhoutte et al., 2001). The subcellular localization of HA-tagged versions of Elk-1 was analyzed after HA-staining, together with MAP2 (Microtubule-Associated Protein 2, a neuritic marker) and a Hoechst labeling (Fig. 3A). In control conditions, HA–Wt–Elk-1 was found in both cytoplasmic (including neurites) and nuclear compartments (Fig. 3A,C). Glutamate induced its enrichment in the nucleus, an effect abrogated by U0126 pretreatment (Fig. 3A,C). Contrasting patterns were observed with HA–DN–Elk-1 and HA–CA–Elk-1. Whereas HA–DN–Elk-1 showed neuritic and somatic expression whatever the treatment, HA–CA–Elk-1 was nuclear in control conditions as well as during glutamate treatment (Fig. 3B,C). U0126 pretreatment failed to affect subcellular localization of these mutated constructs (Fig. 3B,C). These data demonstrate that phosphorylation of Elk-1 on Ser383/389 by activated ERKs is necessary and sufficient to drive its nuclear translocation in response to glutamate.
Blocking interaction between ERKs and the DEF docking domain of Elk-1 reproduces the DN–Elk-1-induced phenotype
Based on overexpression of Elk-1 mutants, we showed that phosphorylation of Elk-1 by activated ERKs was a necessary and sufficient condition to induce its nuclear translocation. To inhibit the phosphorylation of endogenous Elk-1, we designed a synthetic cell-penetrating peptide, named TAT–DEF–Elk-1, which mimics the interaction between activated ERKs and the DEF docking domain of Elk-1 (Fig. 4A). This DEF docking domain plays a critical role for the control of both Elk-1 binding to activated ERKs and Elk-1 phosphorylation (Fantz et al., 2001). We first verified the penetrability of this peptide into striatal neurons, using a FITC-labeled TAT–DEF–Elk-1 peptide. Striatal neurons were incubated for 1 h with 5 μm TAT–DEF–Elk-1–FITC, followed by washing with fresh culture medium for 30 min. In these conditions, the TAT–DEF–Elk-1–FITC entered into the majority of neurons and failed to affect the cellular morphology or DNA integrity, as shown by the MAP-2 labeling and the Hoechst counterstaining, respectively (Fig. 4B).The selective inhibition of glutamate-induced Elk-1 phosphorylation was then analyzed by Western blot using 5 or 10 μm TAT–DEF–Elk-1. Whatever the doses used, TAT–DEF–Elk-1 inhibited glutamate-induced Elk-1 phosphorylation but not ERK activation (Fig. 4C,D). We used the lowest dose of TAT–DEF–Elk-1 (5 μm) for subsequent analyses. The TAT–DEF–Elk-1 peptide failed to affect the activation of MSK-1, a protein kinase activated by ERK in response to glutamate and critically involved in CREB phosphorylation (Brami-Cherrier et al., 2005) (Fig. 4E). Thus, as opposed to classical MEK inhibitor treatment (Fig. 2), CREB phosphorylation was unaffected by TAT–DEF–Elk-1 (Fig. 4F).
We then used TAT–DEF–Elk-1 to analyze the subcellular localization of Elk-1 during glutamate application. Confocal microscopy analyses (Fig. 5A) showed no nuclear translocation of Elk-1 during glutamate treatment in the presence of TAT–DEF–Elk-1. These data were confirmed biochemically after cellular fractionations (Fig. 5B). This lack of nuclear translocation correlated nicely with the absence of glutamate-mediated Elk-1 phosphorylation in the nucleus (Fig. 5C). In contrast, glutamate-induced ERK nuclear translocation (Fig. 5B) and activation (Fig. 5D) were not affected by the TAT–DEF–Elk-1. As expected, the phosphorylation levels of some important downstream nuclear targets of ERK (Brami-Cherrier et al., 2005) were not affected by the peptide, including MSK-1, CREB, and histone H3 (Fig. 5E–G).
Comparative effects of MEK inhibitor and TAT–DEF–Elk-1 peptide on glutamate-induced gene expression
TAT–DEF–Elk-1 was designed to inhibit Elk-1 phosphorylation induced by activated ERKs, without interfering with MSK1/CREB module or chromatin remodeling via histone H3 phosphorylation. We thus wished to compare the effects of TAT–DEF–Elk-1 and a global MEK inhibitor (U0126) on glutamate-induced gene expression. For this purpose, we chose IEGs that are controlled by the ERK cascade via their SRE and/or CRE binding domains (namely c-Fos, Zif268 and JunB) or via histone H3 phosphorylation (namely c-Jun) (supplemental Fig. 1, available at www.jneurosci.org as supplemental material) (Brami-Cherrier et al., 2007). The U0126 compound had a profound inhibitory role on glutamate-induced c-Fos, Zif268 and JunB induced expression (Fig. 6A–D) and a partial, but significant, inhibitory action on c-Jun expression (Fig. 6E). The effects of TAT–DEF–Elk-1 treatment on gene expression were statistically different from those observed with U0126 (Fig. 6A–E), with a significant inhibition of c-Fos, Zif268 and JunB but no effect on c-Jun expression. These observations were specifically attributable to the inhibition of Elk-1 phosphorylation because we failed to detect any effect of a scramble TAT–DEF–Elk-1 peptide. Transfection assays using the DN–Elk-1 mutant also showed partial blockade of glutamate-induced c-Fos, Zif268 and JunB, but not c-Jun, expression (supplemental Fig. 2, available at www.jneurosci.org as supplemental material). Although overexpression of CA–Elk-1 was not sufficient to increase the expression of basal IEGs, it produced increases of glutamate-induced expression of Zif268, an IEG baring multiple SRE sites in its promoter (supplemental Fig. 2, available at www.jneurosci.org as supplemental material). Thus, although not sufficient, ERK-mediated phosphorylation of Elk-1 seems to be a prerequisite for proper glutamate-induced gene regulations in neurons.
Our data provide evidence that Elk-1 phosphorylation on Ser 383/389 plays a dual role in neurons, and triggers both its nuclear translocation and SRE-driven gene expression.
Role of ERK-dependent Elk-1 activation in neuronal differentiation
Depending on the spatiotemporal profile of ERK activation, the phosphorylation of Elk-1 has been reported to be associated with multiple phenotypes, including differentiation and cell proliferation (Hipskind et al., 1994a,b; York et al., 1998). In PC12 cells, we previously demonstrated that, NGF-induced neuronal differentiation was linked to the activation of a nuclear, truncated, isoform of Elk-1 called sElk-1 (Vanhoutte et al., 2001). However, no study yet addressed the role of Elk-1 phosphorylation and nuclear translocation, in neuronal differentiation of primary cultured neurons. To address this aspect, we compared the effects of TAT–DEF–Elk-1 and U0126, in dendritic and axonal elongation during spontaneous differentiation of striatal neurons in vitro. Because this set of experiments required long lasting incubations of the peptide (from DIV 3 to DIV 7), we used a more stable version composed of the amino acids in their D-conformation. This D-peptide had the same biochemical properties as the peptide synthesized with amino acids in their natural conformations (data not shown). After pharmacological treatments, cells were transfected with GFP to visualize the morphology of neurons, and dendrites were labeled by immunocytochemistry with a MAP2 antibody (Fig. 7A). The length of the axon, which was considered as the longest and thinnest extension, as well as the mean dendritic length per cell, was analyzed. Inhibition of ERK-dependent Elk-1 phosphorylation with TAT–DEF–Elk-1 reduced the dendritic outgrowth to the same extent as the classical MEK inhibitor, U0126 (Fig. 7B, left). With regard to the axon outgrowth, both TAT–DEF–Elk-1 and U0126 tend to reduce the mean axonal length. However, statistical analysis revealed a difference between these two compounds because the global MEK inhibitor significantly reduced the axon length whereas the TAT–DEF–Elk-1 did not (Fig 7B, right). Whereas the global inhibition of the ERK pathway with U0126 revealed a toxic role, the selective inhibition of Elk-1 phosphorylation with the TAT–DEF–Elk-1 did not trigger neuronal death (Fig. 7E).
To further substantiate that the effects of the TAT–DEF–Elk-1 peptide on dendritic elongation was attributable to the suppression of Elk-1 phosphorylation, we used the cDNA constructs encoding for the mutated versions of Elk-1 (DN–Elk-1 and CA–Elk-1). These constructs were tagged with Cherry, and cotransfected with GFP on DIV1 in striatal neurons (Fig. 7C). As controls, striatal neurons were transfected with GFP alone, treated or not with the TAT–DEF–Elk-1 peptide (Fig. 7D). Dendritic elongation measured on DIV7 showed a significant reduction in DN–Elk-1 transfected neurons when compared with GFP alone (Fig. 7C,D). In contrast, CA–Elk-1-containing neurons showed increased dendritic length (Fig. 7C,D). Neither DN- nor CA–Elk-1 constructs did alter neuronal cell survival when compared with GFP alone transfected neurons (Fig. 7E) Importantly, DN–Elk-1 containing neurons and neurons treated with TAT–DEF–Elk-1 showed no significant difference in the mean dendritic length, thus indicating that the effects of the peptide was merely attributable to the suppression of Elk-1 phosphorylation (Fig. 7C,D).
A recent study of forebrain-specific-srf null mice's phenotype pointed out the critical role of the Elk-1 protein partner SRF in neuronal differentiation. Hippocampal neurons of srf-deficient mice showed a decreased expression of Actin mRNA associated with severe impairments of neuritic outgrowth and cytoskeleton dynamics (Knöll et al., 2006). Because Elk-1 activation positively regulates SRF expression levels (Kasza et al., 2005), we analyzed the effect of chronic inhibition of Elk-1 phosphorylation with the TAT–DEF–Elk-1 or U0126 on SRF and Actin expression levels. Immunoblot experiments, showed a significant decrease in SRF and Actin protein expression levels with both treatments (Fig. 8A). To assess the impact of TAT–DEF–Elk-1 and U0126 on the cytoskeleton dynamic, costaining of F-actin, with rhodamine-coupled phalloidin, and tubulin was performed. We observed that neurons bore growth cones with well structured filopodia in control conditions (Fig. 8B, left). In contrast, incubation with the TAT–DEF–Elk-1 peptide led to a collapse of growth cones, as evidenced by the disorganized actin cytoskeleton (Fig. 8B, middle). In the presence of the global ERK inhibitor a complete breakdown of F-actin was found, indicating a drastic impairment of the cytoskeleton dynamics (Fig. 8B, left). Altogether, these data show a specific role of Elk-1 phosphorylation in the control of the cytoskeleton dynamics in neuronal cells.
Discussion
In the present study, we provide the first evidence that the transcription factor Elk-1 translocates from the cytoplasm to the nucleus during phosphorylation in neurons. Phosphorylation of Ser383/389 by activated ERKs plays a dual role in Elk-1 functions, and controls both nuclear translocation and SRE-driven gene expression. Using dominant-negative Elk-1 mutants or a peptide inhibiting the DEF docking domain of Elk-1 to ERKs, we unraveled a fundamental role of Elk-1 phosphorylation in dendritic elongation, an effect associated with decreased expression levels of Actin and SRF as well as severe impairments of the cytoskeleton dynamics.
From overexpression assays in HeLa cells, Elk-1 was initially described as a nuclear transcription factor (Pingoud et al., 1994). We previously demonstrated that this scenario was different in cerebral tissues in which the endogenous Elk-1 was expressed and activated in both the cytoplasm and the nucleus (Sgambato et al., 1998a,b). Herein, we reinforce these observations and provide evidences for an enrichment of Elk-1 expression in the nucleus by activated ERKs, in vivo, in response to cocaine, and in vitro during glutamate stimulation. Importantly, the nuclear translocation of Elk-1 is associated with SRE-driven gene regulation. Thus, similarly to other transcription factors, including STAT 1 (Meyer et al., 2003), NF-AT4 (Shibasaki et al., 1996), and NF-Kappa-B (Mikenberg et al., 2006), Elk-1 undergoes a nuclear translocation required for its role in transcription. The nuclear transport of proteins that are larger than 60 kDa, such as Elk-1, are facilitated by their interaction with importins (α/β) proteins. In this case, the entry to the nucleus is an active process and requires a NLS sequence, which is recognized by the nuclear import machinery (Weis et al., 2003). Importantly, during activation by ERKs, Elk-1 undergoes important conformational changes that increase its interaction with DNA at the SRE site (Yang et al., 1999). One can speculate that such conformational changes could unmask NLS present in Elk-1 and enable its interaction with importins (or karyopherins), as previously described for the transcription factor STAT1 (Fagerlund et al., 2002; McBride et al., 2002).
The phosphorylation-dependent trafficking of Elk-1 to the nucleus is a major observation because, within the cytoplasm, Elk-1 is associated with the mitochondrial PTP (Permeability Transition Pore complex), an interaction that increases in the context of proapoptotic treatments (Barrett and al., 2006b). Furthermore, restricting Elk-1 transcription and translation in neurites, using a focal transfection procedure named “phototransfection”, produces cell death, whereas its introduction and translation in cell bodies does not (Barrett et al., 2006a). Altogether, these data suggest that Elk-1 plays a dual role in neuronal cells, which is clearly driven by its subcellular localization and posttranslational modifications.
Other posttranslational modifications have been described for Elk-1. In this way, its SUMOylation on 3 critical residues (Lys230/249/254), results in a more rapid nuclear translocation of Elk-1 (Salinas et al., 2004). Furthermore, a dynamic interplay between the activating ERK/MAP kinase pathway and the repressive SUMO pathway has been described, whereby ERK activation leads to both phosphorylation of Elk-1 and loss of SUMO conjugation (Yang et al., 2003). Such interplay could be critically involved in the shuttling of Elk-1, with a role of phosphorylation in the nuclear import of Elk-1, whereas SUMOylation could favor its export from the nucleus.
Although Elk-1 possesses two specific docking domains for activated ERK, the D (or DEJL) and the DEF (or FxFP) domains (Jacobs et al., 1999; Sharrocks et al., 2000), recent evidence involves the DEF domain as the most important motif for its phosphorylation on Serine 383 (Fantz et al., 2001). Furthermore, mutating Ser383 into an inactive residue blocks Elk-1 transcriptional activity (Gille et al., 1995). To specifically alter ERK-mediated Elk-1 phosphorylation, we designed a cell-penetrating peptide, the TAT–DEF–Elk-1 peptide, that mimics the DEF domain of Elk-1. As expected, this peptide blocked glutamate-induced Elk-1 phosphorylation and nuclear translocation, without interfering with ERK activation and nuclear translocation. We observed that some important nuclear events driven by activated ERKs were not affected by the peptide, namely phosphorylation of MSK-1, CREB and histone H3. MSK-1 is a direct nuclear target of ERK with no DEF domain (Sharrocks et al., 2000), critically involved in both CREB and histone H3 phosphorylation in striatal neurons (Brami-Cherrier et al., 2005, 2007). As a consequence, the pattern of gene expression induced by glutamate was differently affected by the TAT–DEF–Elk-1 peptide compared with a classical MEK inhibitor, which had a more widespread effect. Thus, the only IEGs that were downregulated by the TAT–DEF–Elk-1 peptide were those carrying SRE-sites in their promoter (c-Fos, JunB, and Zif268), whereas the global MEK inhibitor also blocked SRE-independent events, such as c-Jun induction via histone H3 phosphorylation (Brami-Cherrier et al., 2007).
The role of Elk-1 in neuronal differentiation has been proposed from NGF-treated PC12 cells. We originally described that overexpression of a nonphosphorylatable version of Elk-1 (DN–Elk-1) in PC12 cells blocked their differentiation induced by NGF (Vanhoutte et al., 2001). More recently, PC12 overexpressing a non-SUMOylable mutant of Elk-1, showed a facilitation of neuronal differentiation (Salinas et al., 2004). In the present work, we extend these observations, and show that chronic inhibition of Elk-1 phosphorylation with the TAT–DEF–Elk-1 peptide inhibits spontaneous dendritic outgrowth. Dendritic elongation was inhibited to the same extent with the DN–Elk-1 cDNA construct, indicating that the effects of the peptide was merely attributable to the suppression of Elk-1 phosphorylation. Importantly, inhibition of dendritic elongation induced by TAT–DEF–Elk-1 was associated with an impairment of the cytoskeleton dynamics and a downregulation of SRF and Actin expression. SRF activity is intimately linked to the cytoskeleton dynamics, in particular to the polymerization of G-actin into F-actin (Sotiropoulos et al., 1999). The downregulation of SRF expression found during TAT–DEF–Elk-1 treatment, is in agreement with previous reports, showing that Elk-1 activation positively regulates SRF expression (Kasza et al., 2005). The phenotype observed in the present study correlates with that recently described from a conditional forebrain-specific srf knock-out mice. In this work (Knöll et al., 2006) the authors observed shorter neuritic length and alteration of the cytoskeleton dynamics in hippocampal neurons from deficient mice. These events were associated, similarly to the chronic treatment with TAT–DEF–Elk-1, with impairments of growth cones dynamics and downregulation of Actin mRNA levels. We propose that phosphorylation of Elk-1 is an upstream event in a complex genetic program that controls neuronal differentiation and that TAT–DEF–Elk-1 is a powerful tool to analyze the role of Elk-1 in this process during development or neuronal plasticity, for example in response to cocaine.
Footnotes
-
This work was supported by the Centre National de la Recherche Scientifique, the Agence Nationale pour la Recherche, the Fondation pour la Recherche Médicale (FRM), and Fondation Jérôme Lejeune. J.L. was supported by the Edmond Rothschild Chemical Dependency Institute Beth Israël Medical Center, V.P. by FRM, and P.T. by the Fondation Jérome Lejeune. We thank Dr. Virginie Georget and Richard Schwartzmann (Institut Federatif de Recherche de Biologie Integrative, IFR-83) for their assistance with confocal microscopy. The TAT–DEF–Elk-1 peptide has been patented: EP 05 290 363 and WO 2006/087242.
- Correspondence should be addressed to Dr. Jocelyne Caboche, Université Pierre et Marie Curie-Paris 6, Centre National de la Recherche Scientifique, Unité Mixte de Recherche 7102, 9 quai Saint Bernard, 75005 Paris, France. jocelyne.caboche{at}snv.jussieu.fr