Biochemical and Biophysical Research Communications
Volume 199, Issue 3, 31 March 1994, Pages 1297-1304
Regular ArticleComplete Amino Acid Sequence and Comparative Molecular Modeling of HPR from Streptococcus mutans Ingbritt
References (0)
Cited by (3)
HPr(His~P)-mediated phosphorylation differently affects counterflow and proton motive force-driven uptake via the lactose transport protein of Streptococcus thermophilus
2000, Journal of Biological ChemistryCitation Excerpt :The N terminus of purified HPr from S. thermophilus was analyzed, and the sequence of the first 51 amino acids was determined:1MASKDFHIVAETGIHARPATLLVQTASKFASDITLEYKGKAVNLKSIMGVM51. This amino acid sequence is identical to the N-terminal sequence of HPr from Streptococcas mutans and S. salivarius except for the glutamate residue at position 36, which is variable among HPr proteins purified from Gram-positive bacteria (15, 16). The predicted Enzyme I and HPr(Ser) kinase phosphorylation sites, His-15 and Ser-46, are both present in the HPr protein fromS.
The phosphoenolpyruvate:sugar phosphotransferase system of oral streptococci and its role in the control of sugar metabolism
1997, FEMS Microbiology ReviewsInfluence of the phosphorylation state on the biological activity of a low-molecular mitogen from group A Streptococci
1998, Zentralblatt fur Bakteriologie
Copyright © 1994 Academic Press. All rights reserved.